BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1049 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 2.6 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 6.0 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 6.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 7.9 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +1 Query: 82 YFASLNLTFFVVLTEYTYSFIYNLIKHH*RASVKKFLNLRSLFKFS 219 +F + + F + +Y Y + +++ H R + NL KFS Sbjct: 65 FFDQMGVHFVGFVGQYGYDRVLSVLGRHVRDFLNGLDNLHEYLKFS 110 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +1 Query: 85 FASLNLTFFVVLTEY 129 FA LN+T++++ EY Sbjct: 413 FAVLNVTYWIMFAEY 427 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 203 LCLNLVKIYATLPLRL 250 L L L ++ATLPLRL Sbjct: 136 LLLMLYLLFATLPLRL 151 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +1 Query: 94 LNLTFFVVLTEYTYSFIYNLI 156 +++TF V++ T + +NLI Sbjct: 219 IDITFVVIIRRRTLYYFFNLI 239 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,224 Number of Sequences: 438 Number of extensions: 2512 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -