BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1048 (639 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016421-7|AAO12430.1| 413|Caenorhabditis elegans Hypothetical ... 28 4.9 Z83129-6|CAB63324.1| 101|Caenorhabditis elegans Hypothetical pr... 27 8.6 >AF016421-7|AAO12430.1| 413|Caenorhabditis elegans Hypothetical protein F44E7.5a protein. Length = 413 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 481 QSTKLLRNSFSREKTGKSAPESLLYKAPVNSNCITI 588 Q TKLL + GK+ +++L++ P N+N +++ Sbjct: 350 QVTKLLEREDFKSLYGKTLADAVLFERPFNANSVSV 385 >Z83129-6|CAB63324.1| 101|Caenorhabditis elegans Hypothetical protein W06G6.10 protein. Length = 101 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 464 IITVTISRLSYCEIHSQERKQENQHQNHCC 553 I + + +S+ +I SQ KQ+ N+CC Sbjct: 43 IYVIAVQPVSFSDIESQAVKQDASSPNNCC 72 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,520,809 Number of Sequences: 27780 Number of extensions: 230990 Number of successful extensions: 577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -