BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1046 (655 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 30 3.2 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 30 3.2 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 30 3.2 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +1 Query: 463 SMVSKHFKVNKYPQ-----RVRPQLARGQSQLHKKQVFIK 567 ++V KH V+ P R RP L GQSQ H K +FIK Sbjct: 129 TLVQKHIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIK 168 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +1 Query: 463 SMVSKHFKVNKYPQ-----RVRPQLARGQSQLHKKQVFIK 567 ++V KH V+ P R RP L GQSQ H K +FIK Sbjct: 129 TLVQKHIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIK 168 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +1 Query: 463 SMVSKHFKVNKYPQ-----RVRPQLARGQSQLHKKQVFIK 567 ++V KH V+ P R RP L GQSQ H K +FIK Sbjct: 129 TLVQKHIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIK 168 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,213,949 Number of Sequences: 53049 Number of extensions: 409563 Number of successful extensions: 789 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2786177250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -