BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1045 (760 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0441 - 14037497-14038006,14038208-14038369 28 7.0 03_01_0082 + 653041-653137,653219-653496,653596-653689,653804-65... 28 7.0 >05_03_0441 - 14037497-14038006,14038208-14038369 Length = 223 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 196 FHLKASYYTRVTDMSISRITSSPPPNTFNTA 288 FHLK +YY TD + T PPP+ + A Sbjct: 57 FHLKPTYYNTRTDKNTLISTLLPPPSVTSGA 87 >03_01_0082 + 653041-653137,653219-653496,653596-653689,653804-653886, 654027-654247,654395-654533,654628-654710,654824-655036, 655099-655494,655587-655758,656085-656276,656363-656569, 656661-656753,656957-657156,657329-657838,658114-658184, 658322-658963,659057-659207,659425-659665 Length = 1360 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 145 VAAARIVDTKRTLEYI*VKLVDPRPPNSCSPGDPLVL 35 V AAR+V + + + + V + PR P+ SPGD VL Sbjct: 43 VDAARLVASFQVFDGVRVHGIQPRCPDGPSPGDVTVL 79 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,963,338 Number of Sequences: 37544 Number of extensions: 290745 Number of successful extensions: 1107 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1094 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -