BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1042 (671 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 25 0.50 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 2.6 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.6 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 4.6 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 22 4.6 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 21 8.1 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 21 8.1 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.4 bits (53), Expect = 0.50 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 529 CVQMHVQFTVAYGYV 573 CV ++VQF+V YG+V Sbjct: 696 CVPINVQFSVLYGFV 710 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.0 bits (47), Expect = 2.6 Identities = 17/75 (22%), Positives = 29/75 (38%) Frame = -2 Query: 514 FFTSTALMVMLSPNDSCSAILLAYAQYGDKVTCAYSIHSSSDQFFISASQYXXXXXXXX* 335 F+T ++ + + C + A+ G+KVT SI S F + S+ Sbjct: 235 FYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLP 294 Query: 334 LYLNPLTIKLLINAV 290 L L ++N V Sbjct: 295 LIAKYLLFTFIMNTV 309 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +1 Query: 178 PPFYFINTRDNFRDNIAEHVFDMLLEDMARLK 273 PP Y + F D + + +++ + D A +K Sbjct: 158 PPMYEVMPHLYFNDEVMQKAYNIAMGDTADMK 189 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +1 Query: 178 PPFYFINTRDNFRDNIAEHVFDMLLEDMARLK 273 PP Y + F D + + +++ + D A +K Sbjct: 158 PPMYEVMPHLYFNDEVMQKAYNIAMGDTADMK 189 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/10 (60%), Positives = 10/10 (100%) Frame = -3 Query: 291 CLQWDNFQTS 262 CL+W+N+Q+S Sbjct: 8 CLRWNNYQSS 17 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 22.2 bits (45), Expect = 4.6 Identities = 6/10 (60%), Positives = 10/10 (100%) Frame = -3 Query: 291 CLQWDNFQTS 262 CL+W+N+Q+S Sbjct: 8 CLRWNNYQSS 17 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/32 (21%), Positives = 18/32 (56%) Frame = +1 Query: 184 FYFINTRDNFRDNIAEHVFDMLLEDMARLKII 279 F ++ NF++NI + + + L++ K++ Sbjct: 70 FNIVDESGNFKENIVQELTSIYLDENVIKKLV 101 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/32 (21%), Positives = 18/32 (56%) Frame = +1 Query: 184 FYFINTRDNFRDNIAEHVFDMLLEDMARLKII 279 F ++ NF++NI + + + L++ K++ Sbjct: 70 FNIVDESGNFKENIVQELTSIYLDENVIKKLV 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,593 Number of Sequences: 438 Number of extensions: 3624 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -