BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1041 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 25 1.6 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.1 AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutath... 24 3.7 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 4.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 4.8 CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 23 6.4 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 25.4 bits (53), Expect = 1.6 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = +3 Query: 291 TAADALRVGAGIADVTGPPAEIAFMGYAQ-LEQIGHG-IHLRQFS-RAFVIEDNSGDTVK 461 T +A G + V G + +G+ + L ++ G I LRQ + +++ +GD+V Sbjct: 152 TGGEAANDGKPLGFVAGVISRERIIGFERMLWRVSRGNIFLRQATLEESLVDPKTGDSVH 211 Query: 462 RLVFVS 479 ++VFV+ Sbjct: 212 KIVFVA 217 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.1 Identities = 7/24 (29%), Positives = 17/24 (70%) Frame = -2 Query: 119 ERQHHQQFCRVLQFAQYEIQSSTA 48 +R+HH + C++ + ++ E+ ST+ Sbjct: 400 KRKHHSKLCKIGRLSEVEVVPSTS 423 >AY278448-1|AAP37005.1| 147|Anopheles gambiae microsomal glutathione transferase GSTMIC3protein. Length = 147 Score = 24.2 bits (50), Expect = 3.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 332 VSYASPDTQRIRRRH 288 V+Y PD +R+RR H Sbjct: 56 VAYDDPDVERVRRAH 70 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 4.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 330 QLCQPRHAAHPPPSRTQARTTRITLYFSSKLCSCYLSKTSENNYVCN 190 Q+ Q H H S + + T + FSS + SC+L +++ + N Sbjct: 1356 QIEQGNHFLHLTRSGSVSATLMPKIQFSSLIVSCWLRGSNKQQNIEN 1402 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 4.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 330 QLCQPRHAAHPPPSRTQARTTRITLYFSSKLCSCYLSKTSENNYVCN 190 Q+ Q H H S + + T + FSS + SC+L +++ + N Sbjct: 1357 QIEQGNHFLHLTRSGSVSATLMPKIQFSSLIVSCWLRGSNKQQNIEN 1403 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +2 Query: 449 GHC*TTGLRVC*CCDDGTWSRKEVIRRLQKRFGV 550 G+C GL + CD V+ +RFGV Sbjct: 148 GYCVAGGLELALMCDLRVMEENAVLGFFNRRFGV 181 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 704,796 Number of Sequences: 2352 Number of extensions: 14744 Number of successful extensions: 86 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -