BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1038 (656 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 47 6e-07 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 47 6e-07 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 47 6e-07 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 45 2e-06 AY748848-1|AAV28194.1| 148|Anopheles gambiae cytochrome P450 pr... 27 0.69 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 46.8 bits (106), Expect = 6e-07 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = +3 Query: 21 QQYCLKWNSFGSNLATSFANLWNSESLADVTLYCE 125 QQYCL+WN+ SNL T L E L DVTL CE Sbjct: 51 QQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACE 85 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 46.8 bits (106), Expect = 6e-07 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = +3 Query: 21 QQYCLKWNSFGSNLATSFANLWNSESLADVTLYCE 125 QQYCL+WN+ SNL T L E L DVTL CE Sbjct: 51 QQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACE 85 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 46.8 bits (106), Expect = 6e-07 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = +3 Query: 21 QQYCLKWNSFGSNLATSFANLWNSESLADVTLYCE 125 QQYCL+WN+ SNL T L E L DVTL CE Sbjct: 51 QQYCLRWNNHQSNLTTVLTTLLQDEKLCDVTLACE 85 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 44.8 bits (101), Expect = 2e-06 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = +3 Query: 21 QQYCLKWNSFGSNLATSFANLWNSESLADVTLYCE 125 QQYCL+WN+ NL T L E L DVTL CE Sbjct: 3 QQYCLRWNNHQPNLTTVLTTLLQDEKLCDVTLACE 37 >AY748848-1|AAV28194.1| 148|Anopheles gambiae cytochrome P450 protein. Length = 148 Score = 26.6 bits (56), Expect = 0.69 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +2 Query: 5 HGLAAATVLPKMEQLWFEPRHVIREPLEFGESRRCHTLLRR 127 H +L ++++LW P + R ++ E ++C +L R Sbjct: 70 HEKIGEIMLNRLQKLWLHPDIIFRCTRQYREQQKCLDILHR 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,411 Number of Sequences: 2352 Number of extensions: 11356 Number of successful extensions: 35 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -