BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1038 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 46 4e-07 AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. 44 1e-06 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 44 1e-06 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.8 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 7.8 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 45.6 bits (103), Expect = 4e-07 Identities = 16/36 (44%), Positives = 26/36 (72%) Frame = +3 Query: 21 QQYCLKWNSFGSNLATSFANLWNSESLADVTLYCEG 128 Q +CL+WN++ S++ ++F NL + E DVTL C+G Sbjct: 5 QHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACDG 40 >AB095513-1|BAC76335.1| 39|Apis mellifera brood-complex protein. Length = 39 Score = 44.4 bits (100), Expect = 1e-06 Identities = 16/35 (45%), Positives = 25/35 (71%) Frame = +3 Query: 21 QQYCLKWNSFGSNLATSFANLWNSESLADVTLYCE 125 Q +CL+WN++ S++ ++F NL + E DVTL CE Sbjct: 5 QHFCLRWNNYQSSITSAFENLRDDEDFVDVTLACE 39 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 44.0 bits (99), Expect = 1e-06 Identities = 19/40 (47%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +3 Query: 21 QQYCLKWNSFGSNLATSFANLWNSESLADVTLYC-EGELK 137 Q YCL+WN++ SN+ + F L +E+ DVTL C E LK Sbjct: 9 QHYCLRWNNYQSNMTSVFHQLLQTEAFVDVTLACNEASLK 48 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 569 PPDRSTLVQHSENGIV 616 P D++TL +NGIV Sbjct: 204 PKDKATLADQIKNGIV 219 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 569 PPDRSTLVQHSENGIV 616 P D++TL +NGIV Sbjct: 199 PKDKATLADQIKNGIV 214 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,853 Number of Sequences: 438 Number of extensions: 3483 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -