BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1037 (647 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 23 1.6 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 2.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.2 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 6.6 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 260 CYLLYGLVKTVIFVLFILKRIQNNKVNLRCELI 162 C L GL+K + V+F L + + N+ E+I Sbjct: 248 CTTLIGLIKNCVIVIFELYYLSHVCQNVSTEVI 280 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 145 IWWYIQXXXXXXFCKM*LDSYTLRLI 68 IW+ I FCK L++Y+L+LI Sbjct: 304 IWYSILIKKADSFCKKKLENYSLQLI 329 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 9 FNFFILLITHYFTYCVLDYKINLRV*LSSY 98 + F ILL +YF Y + + ++L L Y Sbjct: 105 YAFIILLCVYYFYYAFIIFTVHLLFLLCIY 134 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.4 bits (43), Expect = 6.6 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = +1 Query: 523 CLSSYLYCYD 552 C++ + YCYD Sbjct: 247 CITQFYYCYD 256 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,347 Number of Sequences: 336 Number of extensions: 2223 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -