BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1037 (647 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118700-1|AAM50560.1| 414|Drosophila melanogaster AT19640p pro... 28 9.5 AY099098-1|AAM28948.1| 414|Drosophila melanogaster TRH-like rec... 28 9.5 AE013599-1212|AAF58717.1| 414|Drosophila melanogaster CG13229-P... 28 9.5 >AY118700-1|AAM50560.1| 414|Drosophila melanogaster AT19640p protein. Length = 414 Score = 28.3 bits (60), Expect = 9.5 Identities = 8/31 (25%), Positives = 21/31 (67%) Frame = -2 Query: 496 MLLKVHFTNIMFSLDKGITLLYFIWTCISLK 404 +L+ +HFT I+ ++ G+T+ +W ++++ Sbjct: 152 LLVHMHFTQILHTISIGLTVTLAVWRYVAIR 182 >AY099098-1|AAM28948.1| 414|Drosophila melanogaster TRH-like receptor protein. Length = 414 Score = 28.3 bits (60), Expect = 9.5 Identities = 8/31 (25%), Positives = 21/31 (67%) Frame = -2 Query: 496 MLLKVHFTNIMFSLDKGITLLYFIWTCISLK 404 +L+ +HFT I+ ++ G+T+ +W ++++ Sbjct: 152 LLVHMHFTQILHTISIGLTVTLAVWRYVAIR 182 >AE013599-1212|AAF58717.1| 414|Drosophila melanogaster CG13229-PA protein. Length = 414 Score = 28.3 bits (60), Expect = 9.5 Identities = 8/31 (25%), Positives = 21/31 (67%) Frame = -2 Query: 496 MLLKVHFTNIMFSLDKGITLLYFIWTCISLK 404 +L+ +HFT I+ ++ G+T+ +W ++++ Sbjct: 152 LLVHMHFTQILHTISIGLTVTLAVWRYVAIR 182 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,898,073 Number of Sequences: 53049 Number of extensions: 323683 Number of successful extensions: 626 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2744900550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -