SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1035
         (518 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855501-1|ABH88188.1|  146|Tribolium castaneum chemosensory pro...    23   1.2  
S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    23   2.1  
AJ850289-1|CAH64509.1|  533|Tribolium castaneum putative esteras...    21   6.5  
AJ850288-1|CAH64508.1|  510|Tribolium castaneum putative esteras...    21   6.5  
AJ850287-1|CAH64507.1|  509|Tribolium castaneum putative esteras...    21   6.5  

>DQ855501-1|ABH88188.1|  146|Tribolium castaneum chemosensory
           protein 15 protein.
          Length = 146

 Score = 23.4 bits (48), Expect = 1.2
 Identities = 15/57 (26%), Positives = 25/57 (43%)
 Frame = +3

Query: 33  FIVFTALLACTAAAPGLLLHEAPVVAAVHTPVIHTVPIVAAKTTVTKSSQVVNHGST 203
           F+VF ALL   ++   L+L E   +        + +  V  K   TK ++ +  G T
Sbjct: 7   FLVFGALLTYVSSVEYLILREIDTILKNDQMTRNYLDCVLDKGKCTKEAEKLKKGIT 63


>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 22.6 bits (46), Expect = 2.1
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +1

Query: 313 PNLPHRSCSCED 348
           PN+ H SCS +D
Sbjct: 12  PNIDHNSCSSDD 23


>AJ850289-1|CAH64509.1|  533|Tribolium castaneum putative esterase
          protein.
          Length = 533

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 23 NEIFHCFHRTP 55
          NE F CFH  P
Sbjct: 23 NEAFFCFHGIP 33


>AJ850288-1|CAH64508.1|  510|Tribolium castaneum putative esterase
          protein.
          Length = 510

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 23 NEIFHCFHRTP 55
          NE F CFH  P
Sbjct: 23 NEAFFCFHGIP 33


>AJ850287-1|CAH64507.1|  509|Tribolium castaneum putative esterase
          protein.
          Length = 509

 Score = 21.0 bits (42), Expect = 6.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +2

Query: 23 NEIFHCFHRTP 55
          NE F CFH  P
Sbjct: 22 NEAFFCFHGIP 32


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,304
Number of Sequences: 336
Number of extensions: 1825
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12468463
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -