BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1035 (518 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 28 0.066 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 1.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 1.9 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 3.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 5.7 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 5.7 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 27.9 bits (59), Expect = 0.066 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 245 DHGCGMDHRGGMYQSGTMVDNLAALGHS 162 DHG GMD GG Y+S + + +GH+ Sbjct: 99 DHGSGMDGMGG-YRSASPSPGMGHMGHT 125 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.0 bits (47), Expect = 1.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 373 FLRGAPPHSHRQD 411 FLR PP+SH+ D Sbjct: 144 FLRTVPPYSHQTD 156 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +3 Query: 93 EAPVVAAVHTPVIHTVPIVAAKTTVTKSSQVVNH 194 + P++ + PV+ + + T TKS+ V NH Sbjct: 311 QCPMLQKLEKPVLSSSTTTTSPMTSTKSTIVRNH 344 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 51 LLACTAAAPGLLLHEAPVVAAVHTPVIH 134 LLA A G + H P A H ++H Sbjct: 8 LLALLTLAAGEIAHNDPHFAPGHDAIVH 35 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 5.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 1 DLKKNQQK*NLSLFSPHSWPAPPLHP 78 D+ +QQ NLS SP P P + P Sbjct: 867 DIADSQQPLNLSKKSPSPSPRPLVGP 892 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 172 RAAKLSTMVPLWYIPPLWSMPHPW 243 RA L V L ++P S HPW Sbjct: 108 RAKSLGLKVILDFVPNHSSHEHPW 131 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,631 Number of Sequences: 438 Number of extensions: 2613 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14477538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -