BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1032 (615 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3 s... 26 5.0 SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 25 8.7 SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosa... 25 8.7 >SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3 subunit Alp6|Schizosaccharomyces pombe|chr 2|||Manual Length = 821 Score = 25.8 bits (54), Expect = 5.0 Identities = 17/59 (28%), Positives = 33/59 (55%) Frame = +3 Query: 333 RVYPKHPVSHYPLQLNNAIHTRIVTMTIVSQINSDTVIYCPRKIKHTLYVAAVTSPRPR 509 ++Y K P P + N+A+ +++ +VS++ S TVI+ +I + LY+ + S R Sbjct: 59 KIYSKIP----PEENNDALFSKL--SNLVSRLKSQTVIHNKSQILYFLYLLSPISQSSR 111 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 25.0 bits (52), Expect = 8.7 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 114 STCEVQASTFRPKF--PAHPV*YNLLQLYNAILTQI 215 STC+ A TF PKF NL L+ A++ QI Sbjct: 163 STCKYSAFTFLPKFLKEQFSKYANLFFLFTAVVQQI 198 >SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 466 Score = 25.0 bits (52), Expect = 8.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 118 LVKFRRLPSDQNSLRILYNITCFNFTTRFLHR 213 L+K +RLP N+L I + I N + R ++R Sbjct: 129 LIKTKRLPKPFNNLLIQFQIQVPNVSRRTVYR 160 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,209,148 Number of Sequences: 5004 Number of extensions: 39283 Number of successful extensions: 75 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -