BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1031 (635 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 2.8 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 8.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.6 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 8.6 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.0 bits (47), Expect = 2.1 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 352 DGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 477 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 124 LPAREGGDHRQRPGQQDH 177 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 8.6 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = -1 Query: 497 VITAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCF-M 321 +ITAF +VLP+ A +++ F L K + Y + + + ++ + C+ + Sbjct: 87 LITAFLSVLPQLAWDITYRFYGGFLLCKVVKYGQTLGPYLSSYVLMATAIDRHQAICYPL 146 Query: 320 SACTVASSNLRPMRRLA 270 + C+ S + M LA Sbjct: 147 TYCSWTSRRSKVMVYLA 163 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 123 TPTQEYVVPRSIPT 82 TPT + VV R+IP+ Sbjct: 15 TPTDQRVVTRTIPS 28 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 537 KDAGSISGLNRSPESSIEPT 596 + AGSI G + +PE+ P+ Sbjct: 85 RSAGSIPGASSTPENKTFPS 104 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,995 Number of Sequences: 336 Number of extensions: 3785 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -