BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1028 (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces ... 29 0.55 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 25 9.0 SPAC19G12.14 |its3||1-phosphatidylinositol-4-phosphate 5-kinase ... 25 9.0 SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|... 25 9.0 >SPCC1494.07 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1502 Score = 29.1 bits (62), Expect = 0.55 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 291 YFFQSLPQDQQKSTQTFWPNIILHNYETTTTIW 389 Y FQSL K+ W NI++ + + TIW Sbjct: 605 YIFQSLSPTIVKNDNESWKNIVMELIKASETIW 637 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 25.0 bits (52), Expect = 9.0 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +2 Query: 377 NDDMVILLILYNKNHIVDFKHLKYIIQNGYTY*IL 481 ND+ I +L + IVDF HL + I G Y IL Sbjct: 963 NDESAIFSVL---DDIVDFNHLTWSILFGENYIIL 994 >SPAC19G12.14 |its3||1-phosphatidylinositol-4-phosphate 5-kinase Its3|Schizosaccharomyces pombe|chr 1|||Manual Length = 742 Score = 25.0 bits (52), Expect = 9.0 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -1 Query: 467 YSRFE*CILNA*SLQCDFYYIK*VELPY-RRCRFIIMQNNVWP 342 Y +E N +L FY + V+LP+ R+ F++M NN++P Sbjct: 394 YDYYEHVKNNPNTLISQFYGLHRVKLPFGRKIHFVVM-NNLFP 435 >SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 784 Score = 25.0 bits (52), Expect = 9.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 372 FHNYAK*CLARKFVLIFVDLVVRTEKSNRV 283 F N+A RKFV+ +V L+++ E +R+ Sbjct: 148 FVNHALCAALRKFVMDYVVLIMQCENQSRI 177 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,492,224 Number of Sequences: 5004 Number of extensions: 51717 Number of successful extensions: 110 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -