BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1025 (567 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 55 2e-09 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 6.9 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 23 9.2 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 9.2 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 54.8 bits (126), Expect = 2e-09 Identities = 36/91 (39%), Positives = 51/91 (56%), Gaps = 6/91 (6%) Frame = +3 Query: 255 GIPATLNYIPLDAPY-EPSPKLTPYPSF*GNEL-SNCQTG---LTTVYRVKADQCDRXWV 419 GIP+TLN + L P+ + L PYP+F NEL ++ Q + TVYR + D+CDR W Sbjct: 74 GIPSTLNVVDLSPPFPNTNVILKPYPNFALNELRADLQPDANRIVTVYRPRVDRCDRLWF 133 Query: 420 LDVGTYGY-DNVTNVCPYTLNVFDLNTDQII 509 +D G N T V ++ DLNT++ I Sbjct: 134 VDTGMMEIPGNFTVVQRPSVWSIDLNTNEPI 164 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.0 bits (47), Expect = 6.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 312 SGMVHMERPVECSSK*LGYRAPPR 241 SG H+ER +E + R PPR Sbjct: 66 SGSSHLERTIELTFSPADCRLPPR 89 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 22.6 bits (46), Expect = 9.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 354 NCQTGLTTVYRVKADQC 404 NC+ + VY+ K D+C Sbjct: 138 NCKNAVPIVYQSKIDEC 154 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 9.2 Identities = 6/22 (27%), Positives = 11/22 (50%) Frame = +2 Query: 419 IRRWHLWIRQRYKCVPVHAQCI 484 + R H W+R + P +C+ Sbjct: 686 VERVHAWMRHHLQLAPEKTECV 707 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,603 Number of Sequences: 2352 Number of extensions: 12114 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -