BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1017 (603 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U14635-8|AAK84492.1| 307|Caenorhabditis elegans Collagen protei... 29 1.9 L15418-1|AAA17445.1| 307|Caenorhabditis elegans col-36 collagen... 29 1.9 Z72516-2|CAA96689.2| 513|Caenorhabditis elegans Hypothetical pr... 28 5.9 >U14635-8|AAK84492.1| 307|Caenorhabditis elegans Collagen protein 36 protein. Length = 307 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 385 NCNTTHYRANWVPGPPSSIVTTAAPPFKP 299 N N H+ A VPG SI+++A PP +P Sbjct: 132 NGNDGHHGAPGVPGKEGSILSSALPPSEP 160 >L15418-1|AAA17445.1| 307|Caenorhabditis elegans col-36 collagen protein. Length = 307 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 385 NCNTTHYRANWVPGPPSSIVTTAAPPFKP 299 N N H+ A VPG SI+++A PP +P Sbjct: 132 NGNDGHHGAPGVPGKEGSILSSALPPSEP 160 >Z72516-2|CAA96689.2| 513|Caenorhabditis elegans Hypothetical protein T25G3.3 protein. Length = 513 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 50 YYNSVRLVSFDANTNNPIFLMEFGMEIV*TCRKNII 157 Y+ + LVS D N + F +EIV CR NI+ Sbjct: 218 YHYAQELVSHDTKNNTYDYKHTFCVEIVPICRDNIV 253 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,638,089 Number of Sequences: 27780 Number of extensions: 341890 Number of successful extensions: 834 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1289949676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -