Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1016
         (655 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    21   8.9  
AM712904-1|CAN84643.1|   86|Tribolium castaneum hypothetical pro...    21   8.9  

>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 6/10 (60%), Positives = 6/10 (60%)
 Frame = +3

Query: 60  TCWSSCDAIT 89
           TCW  CD  T
Sbjct: 884 TCWRECDKAT 893


>AM712904-1|CAN84643.1|   86|Tribolium castaneum hypothetical
           protein protein.
          Length = 86

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 1/35 (2%)
 Frame = -3

Query: 236 GYIS-VGTLNMRNVIKLNINIYFASSNYSNLHPFV 135
           GY+     L + N   ++ N Y+ ++ Y+   P+V
Sbjct: 44  GYVKHFHPLALSNKNAIDFNYYYYAATYARFGPYV 78


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,341
Number of Sequences: 336
Number of extensions: 2680
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16865010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)