BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1016 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43676| Best HMM Match : Ion_trans (HMM E-Value=1.2e-39) 29 4.4 SB_42364| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_46921| Best HMM Match : Endomucin (HMM E-Value=6.3) 28 7.6 >SB_43676| Best HMM Match : Ion_trans (HMM E-Value=1.2e-39) Length = 605 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/46 (26%), Positives = 27/46 (58%) Frame = -1 Query: 655 VNSKHQKSVAVDDLIEPCIR*PVFI*LHAGRWTQRVDEGSRRLTSS 518 +NS H+ +++ ++PC R P+ + + + R ++ + S+R SS Sbjct: 551 INSTHESEEIIEETVKPCGRNPLGLSMESVRDSRTSNRKSKRSNSS 596 >SB_42364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 82 ASHEDQHVLHKHLKGHGAAR 23 +SH H+ HK LKGHG ++ Sbjct: 86 SSHAQHHLGHKFLKGHGTSK 105 >SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +3 Query: 375 YRVQRGHGEGEHKIPRQRHADLPAQQNFEIRPGDERRQEAKTGGANIP 518 YR R H E K R ++ D + E +P R+ K GG + P Sbjct: 236 YRKLRNHVNRERKSCRSKYYDAKVEHLKESKPSTWWREVKKLGGMSAP 283 >SB_46921| Best HMM Match : Endomucin (HMM E-Value=6.3) Length = 312 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 419 WNFMFTFSMSSLYAIVTIRDHINIYQNIE 333 W TF L+ IVT+R HI+++ N E Sbjct: 227 WRLTLTF-YKLLHVIVTMRPHISLFSNTE 254 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,829,390 Number of Sequences: 59808 Number of extensions: 372910 Number of successful extensions: 772 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -