BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1015 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizo... 28 1.2 SPAC6G10.06 |||amino acid oxidase |Schizosaccharomyces pombe|chr... 26 6.3 SPBC11G11.04 |trs20||TRAPP complex subunit Trs20 |Schizosaccharo... 25 8.4 >SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 28.3 bits (60), Expect = 1.2 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -3 Query: 108 SVTLYFYYGTMWYYRSLF*HFILFFLQNKKL 16 +V +FY TM++Y + H++ FF+ ++L Sbjct: 639 TVRNHFYRSTMFFYMTYVFHYLPFFIMGRQL 669 >SPAC6G10.06 |||amino acid oxidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 376 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = -2 Query: 289 ICCSNLKNNSLAIHCLNVMN*IKNLLFFN*KP*IYFLAKLKGRCFF 152 +CC N N + + + L F P + L K RCFF Sbjct: 237 VCCLNTMGNLNICKTTEIFSKNREQLIFMGTPKFHLLPKDSNRCFF 282 >SPBC11G11.04 |trs20||TRAPP complex subunit Trs20 |Schizosaccharomyces pombe|chr 2|||Manual Length = 136 Score = 25.4 bits (53), Expect = 8.4 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = -1 Query: 251 SLP*CDELNKKSVVFQLKTMNIFSSQIKRQMFFFSNK*INVFHQSQVAVSPYIFIMEL 78 SL D+L S F +KT++ F SN + HQ+Q A + +F EL Sbjct: 43 SLDIVDQLQWTSNAFYMKTIDQFHEMYISAYVTPSNMRFMLLHQNQSADNIKLFFQEL 100 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,955,840 Number of Sequences: 5004 Number of extensions: 60891 Number of successful extensions: 90 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -