BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1014 (613 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0735 + 35859984-35860532 31 0.72 01_07_0083 + 40970890-40971015,40971886-40971994,40972679-409727... 29 3.8 05_04_0124 + 18232961-18236636,18236810-18237288,18237549-182376... 28 5.1 05_04_0122 + 18198594-18202269,18202551-18202591,18203273-182032... 28 5.1 01_06_0656 - 30926858-30927040,30927141-30927281,30927373-309274... 28 5.1 10_08_0666 - 19691985-19692216,19692327-19692404,19692508-196928... 27 8.9 09_06_0198 - 21496692-21496991,21497111-21497258,21497341-214975... 27 8.9 06_01_0018 + 194295-194640,194679-194917,195737-195885,196248-19... 27 8.9 03_05_0759 - 27500941-27501568,27503540-27504154,27504228-27504598 27 8.9 03_05_0612 + 26117306-26118045,26118151-26118680,26119247-261192... 27 8.9 01_06_1618 - 38681729-38683989,38685577-38685796 27 8.9 01_05_0110 + 18225431-18226992,18227158-18228132,18228343-182284... 27 8.9 01_01_0994 - 7861310-7862119,7862378-7862498,7862718-7862901,786... 27 8.9 01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237,448... 27 8.9 >03_06_0735 + 35859984-35860532 Length = 182 Score = 31.1 bits (67), Expect = 0.72 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = +2 Query: 236 LQRQSRLNTNLAQEQAVDGVWAVEDKKWQALDALKTAEAQLDGAVASQAVQ 388 +QR+ + + + + +A E++KW+A++ L EA G+V S A + Sbjct: 72 VQREYSVRRDAVEVEVEVSRFAAEERKWEAVEELAAGEALFVGSVVSVAAR 122 >01_07_0083 + 40970890-40971015,40971886-40971994,40972679-40972790, 40972944-40973100,40973609-40973761,40974143-40974292, 40974803-40974999,40975446-40975473 Length = 343 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 418 RCGSHGALS*LYGLTSHCTV*LRFSCFESVQGLPFLI-LNCPNTIDSLFLS 269 +C S + +Y T HC+ CF +Q P+LI + CP D L LS Sbjct: 84 KCSSPINVYAIYSYTIHCSTQAENICFWFIQNSPYLICVICPE--DHLHLS 132 >05_04_0124 + 18232961-18236636,18236810-18237288,18237549-18237629, 18238033-18238041,18238096-18238248 Length = 1465 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +2 Query: 245 QSRLNTNLAQEQ---AVDGVWAVEDKKWQALDAL 337 Q RL L+Q++ +D VW +++KW+AL L Sbjct: 257 QQRLREELSQKRYLLVLDDVWNEDEQKWEALRTL 290 >05_04_0122 + 18198594-18202269,18202551-18202591,18203273-18203281, 18203336-18203551,18204257-18204361,18204761-18204919 Length = 1401 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +2 Query: 245 QSRLNTNLAQEQ---AVDGVWAVEDKKWQALDAL 337 Q RL L+Q++ +D VW +++KW+AL L Sbjct: 257 QQRLREELSQKRYLLVLDDVWNEDEQKWEALRTL 290 >01_06_0656 - 30926858-30927040,30927141-30927281,30927373-30927489, 30927696-30927784,30927870-30928010,30928084-30928171, 30928280-30928342,30928544-30928699,30928778-30928870, 30929095-30929176,30929426-30929493,30929575-30930633 Length = 759 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 3 KMRFLIVSALLACVAAAPSHLVPFPAVAYHAV 98 + RF+ A+ + A+ HL P PA YHA+ Sbjct: 35 RRRFVAFLAISVALVASYHHLAPAPASRYHAL 66 >10_08_0666 - 19691985-19692216,19692327-19692404,19692508-19692837, 19692913-19693158,19693224-19693483,19694469-19695023 Length = 566 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 21 VSALLACVAAAPSHLVPFPAVAY 89 V A+LA APS +PFPA A+ Sbjct: 225 VPAVLAAAGGAPSRRLPFPAGAF 247 >09_06_0198 - 21496692-21496991,21497111-21497258,21497341-21497578, 21497679-21497889,21497977-21498170,21498263-21498364, 21498525-21499879,21501193-21501494,21501600-21501750, 21501838-21502102,21502155-21502362,21502467-21502660, 21502749-21502850,21503481-21503680,21504010-21504846, 21505806-21506107,21506209-21506359,21506447-21506684, 21506764-21506971,21507078-21507271,21507322-21507462, 21513484-21514811,21515923-21516227,21516331-21516481, 21516570-21516807,21516881-21517088,21517197-21517366, 21517451-21517549,21517708-21519029,21521601-21521683 Length = 3314 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 37 PALQPHLPIWCHSQP-WRTTLWPSQLLSPLY 126 P L +W S+P WRTT+W L S Y Sbjct: 2675 PETSLQLVMWNGSRPYWRTTVWTGYLTSGQY 2705 >06_01_0018 + 194295-194640,194679-194917,195737-195885,196248-196342, 196685-196780,197248-197399,198683-198823,199068-199319, 199463-199603,199686-200003,200146-200232,201025-202006, 202091-202179,202968-203072,203155-204306,204844-205359, 205455-205650,206299-207182 Length = 1979 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +1 Query: 115 SPLYHLETFRLQRSTPRSKPLISPKRRPIKLSQSMTKTQKITTSKP 252 +P HL+ FRL R+ P + ++ P++L + ++TQ S P Sbjct: 1797 APAPHLQ-FRLPRAHPTAPVNQQQRQLPVRLESTCSRTQLTPVSTP 1841 >03_05_0759 - 27500941-27501568,27503540-27504154,27504228-27504598 Length = 537 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 157 TPRSKP-LISPKRRPIKLSQSMTKTQKITTSKPFKH*SSSGTGCRWC 294 +P S P S + RP+ S + + + T S P +SS T RWC Sbjct: 409 SPSSSPQCFSTQTRPLVASSNYGSSTRRTRSTPPTSSASSMTSPRWC 455 >03_05_0612 + 26117306-26118045,26118151-26118680,26119247-26119278, 26119910-26121175 Length = 855 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 130 GDRVGTTAGMATAWYATAGNGTRWEGA 50 G GT A M + W + NG W GA Sbjct: 209 GQAAGTIADMRSDWASDQRNGVYWRGA 235 >01_06_1618 - 38681729-38683989,38685577-38685796 Length = 826 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +1 Query: 52 HLPIWCHSQPWRTTLWPSQLLSPLYHLETFRLQRSTPRSKPLISPKRRPI 201 ++ IW + P T +W + +PL +T RL S + L+ R P+ Sbjct: 81 YMGIWYNKIPDHTKVWVANRRAPLSDPDTSRLAISADGNMVLLDRARPPV 130 >01_05_0110 + 18225431-18226992,18227158-18228132,18228343-18228437, 18228556-18228842 Length = 972 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 5 DEISDCFRLTGLRCSRTFPSGAIPS 79 D++ +CF+L L+ S +G+IPS Sbjct: 576 DDLGNCFKLQSLKMSNNSLNGSIPS 600 >01_01_0994 - 7861310-7862119,7862378-7862498,7862718-7862901, 7862975-7863070,7863428-7863476,7863555-7863596, 7863684-7863836,7865631-7865705,7866462-7866587 Length = 551 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 2 QDEISDCFRLTGLRCSRTFPSGAIPSRGVPRCGHPS 109 +D++SD T + S G +P G P GHP+ Sbjct: 492 EDKLSDIPEQTEAQASELVKEGPVPVEGKPIDGHPT 527 >01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237, 4486636-4486778,4486819-4486877,4487167-4487200, 4487489-4487629,4487719-4487907,4488027-4488122, 4488163-4488225,4488588-4489097 Length = 630 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +1 Query: 151 RSTPRSKPLISPKRRPI---KLSQSMTKTQKITTSKP 252 RS PRSK S K +P+ K S+S + + K+ S+P Sbjct: 560 RSQPRSKSTSSGKAKPVRSAKPSKSSSPSPKVAKSRP 596 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,367,833 Number of Sequences: 37544 Number of extensions: 328420 Number of successful extensions: 1350 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1349 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -