BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1014 (613 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC027985-1|AAH27985.1| 1063|Homo sapiens MAST1 protein protein. 30 5.6 AD000092-1|AAB51171.1| 1237|Homo sapiens hypothetical human seri... 30 5.6 AB023190-1|BAA76817.1| 1583|Homo sapiens KIAA0973 protein protein. 30 5.6 BC146791-1|AAI46792.1| 1858|Homo sapiens myosin XVI protein. 30 7.4 AL390918-1|CAI15821.1| 1858|Homo sapiens protein ( Human DNA seq... 30 7.4 AL353143-1|CAH73221.1| 1858|Homo sapiens protein ( Human DNA seq... 30 7.4 AL161431-1|CAI15548.1| 1858|Homo sapiens protein ( Human DNA seq... 30 7.4 AL157771-1|CAI16366.1| 1858|Homo sapiens protein ( Human DNA seq... 30 7.4 AL136132-1|CAH70519.1| 1858|Homo sapiens protein ( Human DNA seq... 30 7.4 AB020672-1|BAA74888.2| 1900|Homo sapiens KIAA0865 protein protein. 30 7.4 >BC027985-1|AAH27985.1| 1063|Homo sapiens MAST1 protein protein. Length = 1063 Score = 30.3 bits (65), Expect = 5.6 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +2 Query: 458 IASP-AIKSIATQPPVEESRPSRT*KPALKP*RAPLN-WKSGKLRGTPIR 601 +ASP + +S+++ P +S PSR PA+ R+P+ +SGK G +R Sbjct: 426 LASPMSPRSLSSNPSSRDSSPSRDYSPAVSGLRSPITIQRSGKKYGFTLR 475 >AD000092-1|AAB51171.1| 1237|Homo sapiens hypothetical human serine-threonine protein kinase R31240_1 protein. Length = 1237 Score = 30.3 bits (65), Expect = 5.6 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +2 Query: 458 IASP-AIKSIATQPPVEESRPSRT*KPALKP*RAPLN-WKSGKLRGTPIR 601 +ASP + +S+++ P +S PSR PA+ R+P+ +SGK G +R Sbjct: 587 LASPMSPRSLSSNPSSRDSSPSRDYSPAVSGLRSPITIQRSGKKYGFTLR 636 >AB023190-1|BAA76817.1| 1583|Homo sapiens KIAA0973 protein protein. Length = 1583 Score = 30.3 bits (65), Expect = 5.6 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +2 Query: 458 IASP-AIKSIATQPPVEESRPSRT*KPALKP*RAPLN-WKSGKLRGTPIR 601 +ASP + +S+++ P +S PSR PA+ R+P+ +SGK G +R Sbjct: 946 LASPMSPRSLSSNPSSRDSSPSRDYSPAVSGLRSPITIQRSGKKYGFTLR 995 >BC146791-1|AAI46792.1| 1858|Homo sapiens myosin XVI protein. Length = 1858 Score = 29.9 bits (64), Expect = 7.4 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +1 Query: 25 PPYWPALQPHLPIWCHSQPWRTTLWPSQLLSPLYHLETFRLQRSTPRSKPLISPKRRPIK 204 PP +P L PH P P T P+ SPL LE +L K + P+ Sbjct: 1479 PPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSS-P 1537 Query: 205 LSQSMTKTQKITTSKP 252 LS +K+QK +P Sbjct: 1538 LSPQYSKSQKGDGDRP 1553 >AL390918-1|CAI15821.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-569E4 on chromosome 13 Contains part of a novel gene (KIAA0865), possible ortholog of rat myosin ). Length = 1858 Score = 29.9 bits (64), Expect = 7.4 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +1 Query: 25 PPYWPALQPHLPIWCHSQPWRTTLWPSQLLSPLYHLETFRLQRSTPRSKPLISPKRRPIK 204 PP +P L PH P P T P+ SPL LE +L K + P+ Sbjct: 1479 PPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSS-P 1537 Query: 205 LSQSMTKTQKITTSKP 252 LS +K+QK +P Sbjct: 1538 LSPQYSKSQKGDGDRP 1553 >AL353143-1|CAH73221.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-383F12 on chromosome 13 Contains part of a novel gene (including KIAA0865), possible ortholog of rat asin A2 ). Length = 1858 Score = 29.9 bits (64), Expect = 7.4 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +1 Query: 25 PPYWPALQPHLPIWCHSQPWRTTLWPSQLLSPLYHLETFRLQRSTPRSKPLISPKRRPIK 204 PP +P L PH P P T P+ SPL LE +L K + P+ Sbjct: 1479 PPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSS-P 1537 Query: 205 LSQSMTKTQKITTSKP 252 LS +K+QK +P Sbjct: 1538 LSPQYSKSQKGDGDRP 1553 >AL161431-1|CAI15548.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-54H7 on chromosome 13 Contains the 3' end a novel gene (including KIAA0865) possible ortholog of ). Length = 1858 Score = 29.9 bits (64), Expect = 7.4 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +1 Query: 25 PPYWPALQPHLPIWCHSQPWRTTLWPSQLLSPLYHLETFRLQRSTPRSKPLISPKRRPIK 204 PP +P L PH P P T P+ SPL LE +L K + P+ Sbjct: 1479 PPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSS-P 1537 Query: 205 LSQSMTKTQKITTSKP 252 LS +K+QK +P Sbjct: 1538 LSPQYSKSQKGDGDRP 1553 >AL157771-1|CAI16366.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-67J18 on chromosome 13 Contains the 5' end of a novel gene (including KIAA0865), possible ortholog ). Length = 1858 Score = 29.9 bits (64), Expect = 7.4 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +1 Query: 25 PPYWPALQPHLPIWCHSQPWRTTLWPSQLLSPLYHLETFRLQRSTPRSKPLISPKRRPIK 204 PP +P L PH P P T P+ SPL LE +L K + P+ Sbjct: 1479 PPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSS-P 1537 Query: 205 LSQSMTKTQKITTSKP 252 LS +K+QK +P Sbjct: 1538 LSPQYSKSQKGDGDRP 1553 >AL136132-1|CAH70519.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-141M24 on chromosome 13q33.1-34 Contains part of a novel gene, possible ortholog of rat myosin heavy ). Length = 1858 Score = 29.9 bits (64), Expect = 7.4 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +1 Query: 25 PPYWPALQPHLPIWCHSQPWRTTLWPSQLLSPLYHLETFRLQRSTPRSKPLISPKRRPIK 204 PP +P L PH P P T P+ SPL LE +L K + P+ Sbjct: 1479 PPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSS-P 1537 Query: 205 LSQSMTKTQKITTSKP 252 LS +K+QK +P Sbjct: 1538 LSPQYSKSQKGDGDRP 1553 >AB020672-1|BAA74888.2| 1900|Homo sapiens KIAA0865 protein protein. Length = 1900 Score = 29.9 bits (64), Expect = 7.4 Identities = 24/76 (31%), Positives = 32/76 (42%) Frame = +1 Query: 25 PPYWPALQPHLPIWCHSQPWRTTLWPSQLLSPLYHLETFRLQRSTPRSKPLISPKRRPIK 204 PP +P L PH P P T P+ SPL LE +L K + P+ Sbjct: 1521 PPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSS-P 1579 Query: 205 LSQSMTKTQKITTSKP 252 LS +K+QK +P Sbjct: 1580 LSPQYSKSQKGDGDRP 1595 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,700,244 Number of Sequences: 237096 Number of extensions: 1643045 Number of successful extensions: 11764 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11750 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6522878360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -