BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1013 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 88 6e-18 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 1e-17 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 85 5e-17 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 85 5e-17 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 83 2e-16 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 83 2e-16 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 83 2e-16 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 83 2e-16 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 83 2e-16 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 83 2e-16 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 83 2e-16 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 83 3e-16 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 79 3e-15 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 79 3e-15 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 79 3e-15 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 79 3e-15 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 79 3e-15 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 79 3e-15 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 79 3e-15 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 79 3e-15 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 79 3e-15 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 79 3e-15 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 79 3e-15 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 79 3e-15 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 79 3e-15 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 79 3e-15 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 79 3e-15 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 79 3e-15 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 79 3e-15 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 79 3e-15 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 79 3e-15 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 79 3e-15 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 79 3e-15 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 79 3e-15 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 79 3e-15 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 79 3e-15 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 79 3e-15 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 79 3e-15 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 79 3e-15 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 79 3e-15 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 79 3e-15 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 79 3e-15 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 79 3e-15 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 79 3e-15 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 79 3e-15 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 79 3e-15 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 79 3e-15 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 79 3e-15 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 79 3e-15 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 79 3e-15 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 79 3e-15 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 78 8e-15 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 76 2e-14 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 76 2e-14 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 2e-14 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 75 6e-14 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 75 6e-14 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 6e-14 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 75 6e-14 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 74 1e-13 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 74 1e-13 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 73 2e-13 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 73 2e-13 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 73 2e-13 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 73 2e-13 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 73 2e-13 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 73 2e-13 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 73 2e-13 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 73 2e-13 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 73 2e-13 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 73 2e-13 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 73 2e-13 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 73 2e-13 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 73 2e-13 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 73 2e-13 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 73 2e-13 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 73 2e-13 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 73 2e-13 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 73 2e-13 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 73 2e-13 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 73 2e-13 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 73 2e-13 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 73 2e-13 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 73 2e-13 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 73 2e-13 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 73 2e-13 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 73 2e-13 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 73 2e-13 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 73 2e-13 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 73 2e-13 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 73 2e-13 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 73 2e-13 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 73 2e-13 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 73 2e-13 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 73 2e-13 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 73 2e-13 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 73 2e-13 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 73 2e-13 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 73 2e-13 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 73 2e-13 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 73 2e-13 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 73 2e-13 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 73 2e-13 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 73 2e-13 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 73 2e-13 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 73 2e-13 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 73 2e-13 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 73 2e-13 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 73 2e-13 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 73 2e-13 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 73 2e-13 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 73 2e-13 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 73 2e-13 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 73 2e-13 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 73 2e-13 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 73 2e-13 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 88.2 bits (209), Expect = 6e-18 Identities = 49/95 (51%), Positives = 56/95 (58%) Frame = -3 Query: 589 AYNLPFRHSGCATCWEGRSVRASSLLRSWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCN 410 A + PFR CWEGRSVRASSLLR KG GFPSHDVVKRRPVNCN Sbjct: 587 ASHSPFR---LRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCN 640 Query: 409 TTHYRANWVPGPPSSIVTTAAPPFKPKHITASRQK 305 TTHYRANW ++ + PP I++S Q+ Sbjct: 641 TTHYRANWSSTAVAAALELVDPPGCRNSISSSNQR 675 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 87.4 bits (207), Expect = 1e-17 Identities = 42/70 (60%), Positives = 45/70 (64%) Frame = -3 Query: 550 CWEGRSVRASSLLRSWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANWVPGPP 371 CWEGRSVRASSLLR KG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 26 CWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANWSSTAV 85 Query: 370 SSIVTTAAPP 341 ++ + PP Sbjct: 86 AAALELVDPP 95 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 85.0 bits (201), Expect = 5e-17 Identities = 46/83 (55%), Positives = 50/83 (60%) Frame = -3 Query: 589 AYNLPFRHSGCATCWEGRSVRASSLLRSWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCN 410 A + PFR CWEGRSVRASSLLR KG GFPSHDVVKRRPVNCN Sbjct: 30 ASHSPFR---LRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCN 83 Query: 409 TTHYRANWVPGPPSSIVTTAAPP 341 TTHYRANW ++ + PP Sbjct: 84 TTHYRANWSSTAVAAALELVDPP 106 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 85.0 bits (201), Expect = 5e-17 Identities = 46/83 (55%), Positives = 50/83 (60%) Frame = -3 Query: 589 AYNLPFRHSGCATCWEGRSVRASSLLRSWRKGDVLQGD*VG*RQGFPSHDVVKRRPVNCN 410 A + PFR CWEGRSVRASSLLR KG GFPSHDVVKRRPVNCN Sbjct: 30 ASHSPFR---LRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCN 83 Query: 409 TTHYRANWVPGPPSSIVTTAAPP 341 TTHYRANW ++ + PP Sbjct: 84 TTHYRANWSSTAVAAALELVDPP 106 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 83.4 bits (197), Expect = 2e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 389 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA 508 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLSPA Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPA 72 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 5 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 217 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 372 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 288 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 5 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 5 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 5 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 28 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 262 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 446 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 281 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 131 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 5 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 5 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 582 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 496 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 180 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 82.6 bits (195), Expect = 3e-16 Identities = 42/54 (77%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 572 SPFRLRNL-LGRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 46 SPFRLRNCGEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 82.6 bits (195), Expect = 3e-16 Identities = 48/74 (64%), Positives = 52/74 (70%), Gaps = 1/74 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL* 396 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 5 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPLV 63 Query: 395 GELGTGPPLEYSYN 354 E PP +S N Sbjct: 64 LE---RPPPRWSSN 74 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 135 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 81.0 bits (191), Expect = 9e-16 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +2 Query: 395 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA 508 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA 114 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 473 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 66 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 647 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 556 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 66 SPFRLRNYWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 33 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 12 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 189 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 915 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 965 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 263 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 313 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = -3 Query: 571 RHSGCATCWEGRSVRASSLLRSWRKGDVLQGD 476 RHSGCAT +G SWRKGDVLQGD Sbjct: 87 RHSGCATVGKGDRCGPLRYYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 69 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 119 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 79.4 bits (187), Expect = 3e-15 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 420 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 20 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 3/55 (5%) Frame = -3 Query: 541 GRSVRAS--SLLRSWRKGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 386 GR++ A ++ + KGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 48 GRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 569 PFRLRNLLGRAIGAGLFAITQLAKGG 492 P + LLGRAIGAGLFAIT + G Sbjct: 40 PSQAAQLLGRAIGAGLFAITPAGEKG 65 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 79.0 bits (186), Expect = 3e-15 Identities = 38/58 (65%), Positives = 41/58 (70%) Frame = +2 Query: 404 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHRSPFPTSCAA*MAKW 577 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA + P P + +W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 78.2 bits (184), Expect = 6e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 404 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA 508 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPA 36 Score = 31.1 bits (67), Expect = 0.91 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +3 Query: 513 NSEEARTDRPSQQV 554 NSEEARTDRPSQQ+ Sbjct: 39 NSEEARTDRPSQQL 52 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 77.8 bits (183), Expect = 8e-15 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 572 SPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTA 423 SPFRLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTA Sbjct: 180 SPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 229 Score = 69.7 bits (163), Expect = 2e-12 Identities = 35/51 (68%), Positives = 38/51 (74%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWEN GVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 515 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 565 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 77.0 bits (181), Expect = 1e-14 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +2 Query: 419 HWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHRSPFPTSCAA 562 HWPSFYNVVTGKTLALPNLIALQHIPLSPA + P P SCAA Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 109 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 77.0 bits (181), Expect = 1e-14 Identities = 36/48 (75%), Positives = 37/48 (77%) Frame = +2 Query: 419 HWPSFYNVVTGKTLALPNLIALQHIPLSPAA**RRGPHRSPFPTSCAA 562 HWPSFYNVVTGKTLALPNLIALQHIPLSPA + P P SCAA Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCAA 104 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 76.6 bits (180), Expect = 2e-14 Identities = 43/71 (60%), Positives = 50/71 (70%), Gaps = 1/71 (1%) Frame = -2 Query: 623 KFNAEF*QNINGLQFAISPFRLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQ 447 K + F N ++ IS +LRN GR++ A + QLAKGGCAARRLSWVTPGFSQ Sbjct: 202 KNSKRFQGNSQSSKYCISA-KLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQ 259 Query: 446 SRRCKTTASEL 414 SRRCKTTASEL Sbjct: 260 SRRCKTTASEL 270 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 76.2 bits (179), Expect = 2e-14 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 563 RLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 RLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 267 RLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 76.2 bits (179), Expect = 2e-14 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 563 RLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 RLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 240 RLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 76.2 bits (179), Expect = 2e-14 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 563 RLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 RLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 390 RLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 75.4 bits (177), Expect = 4e-14 Identities = 43/78 (55%), Positives = 48/78 (61%) Frame = +1 Query: 340 RVGQPL*LYSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASCVIA 519 +VGQ L RG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFAS + Sbjct: 44 KVGQLLLFDQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 101 Query: 520 KRPAPIALPNKLRSLNGE 573 + +LRSLNGE Sbjct: 102 EEARTDRPSQQLRSLNGE 119 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 74.9 bits (176), Expect = 6e-14 Identities = 38/51 (74%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 563 RLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 +LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 224 KLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 74.9 bits (176), Expect = 6e-14 Identities = 38/51 (74%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 563 RLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 +LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 251 KLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 577 PFRHSGCATCWEGRSVRASSLLRSWRKG 494 P CWEGRSVRASSLLR KG Sbjct: 246 PVNREKLRNCWEGRSVRASSLLRQLAKG 273 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 74.9 bits (176), Expect = 6e-14 Identities = 38/51 (74%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 563 RLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 +LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 193 KLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 74.9 bits (176), Expect = 6e-14 Identities = 45/86 (52%), Positives = 51/86 (59%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGEMANCKPLIF 600 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE +P Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRPQRS 257 Query: 601 C*NSALNFC*ISSFFNPIGRKSAKSL 678 +SAL PI R+ A L Sbjct: 258 ESHSALRPLGAVKDTRPIPREGAGGL 283 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 74.5 bits (175), Expect = 7e-14 Identities = 38/51 (74%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 563 RLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 +LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 888 QLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 74.5 bits (175), Expect = 7e-14 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 563 RLRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 417 RLRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 530 RLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 560 LRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 560 LRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 358 LRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 41.1 bits (92), Expect = 9e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -3 Query: 568 HSGCATCWEGRSVRASSLLRSWRKG 494 +SG CWEGRSVRASSLLR KG Sbjct: 355 YSGLRNCWEGRSVRASSLLRQLAKG 379 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 560 LRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 560 LRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 560 LRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 LRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 74.1 bits (174), Expect = 1e-13 Identities = 40/70 (57%), Positives = 45/70 (64%) Frame = +1 Query: 364 YSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIAL 543 Y+RG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ Sbjct: 68 YTRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 125 Query: 544 PNKLRSLNGE 573 +LRSLNGE Sbjct: 126 SQQLRSLNGE 135 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 560 LRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 119 LRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 74.1 bits (174), Expect = 1e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = -2 Query: 560 LRNLL-GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 LRN GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 83 LRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = -3 Query: 607 FNKILTAYNLPFRHSGCATCWEGRSVRASSLLRSWRKG 494 F + +A +P SG CWEGRSVRASSLLR KG Sbjct: 67 FEAVNSARLMPEAVSGLRNCWEGRSVRASSLLRQLAKG 104 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 73.7 bits (173), Expect = 1e-13 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 545 GRAIGAGLFAITQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 414 GR++ A + QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 7 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 Score = 34.3 bits (75), Expect = 0.098 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 556 ATCWEGRSVRASSLLRSWRKG 494 A WEGRSVRASSLLR KG Sbjct: 2 AQLWEGRSVRASSLLRQLAKG 22 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS +++ +LRSLNGE Sbjct: 123 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGE 173 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 220 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRTSEEARTDRPSQQLRSLNGE 270 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS +++ +LRSLNGE Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGE 108 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 73.7 bits (173), Expect = 1e-13 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS +++ +LRSLNGE Sbjct: 131 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNSEKARTDRPSQQLRSLNGE 181 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/51 (70%), Positives = 40/51 (78%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS +++ +LRSLNGE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEQARTDRPSQQLRSLNGE 86 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 73.3 bits (172), Expect = 2e-13 Identities = 37/59 (62%), Positives = 42/59 (71%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGEMANCKPLI 597 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE + L+ Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRALL 849 >SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWSNSEEARTDRPSQQLRSLNGE 88 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 73.3 bits (172), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWSNSEEARTDRPSQQLRSLNGE 115 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 85 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 112 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 94 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 86 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 112 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 117 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 88 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 108 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 120 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 96 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 85 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 75 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 100 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 109 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 103 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 119 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 107 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 90 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 266 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 161 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 99 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 78 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 66 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 97 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 431 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 157 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 133 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 89 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 58 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 68 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 88 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 153 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 95 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 390 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 130 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 100 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 66 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 109 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 93 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 184 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 113 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 89 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 193 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 883 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 66 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 110 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 84 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 123 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWGNSEEARTDRPSQQLRSLNGE 117 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 106 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 119 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 306 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 164 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 100 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 86 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 87 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 151 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 164 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 89 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 70 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 108 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 87 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 84 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 61 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 69 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 446 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 95 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 104 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 86 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 169 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 105 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 115 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 118 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 464 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 161 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 117 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 106 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 96 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 211 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 115 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 102 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 138 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 87 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 113 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 92 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 235 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 84 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 90 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 104 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 101 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 84 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 85 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 99 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 89 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 182 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 91 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 134 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 72 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 72.9 bits (171), Expect = 2e-13 Identities = 36/51 (70%), Positives = 39/51 (76%) Frame = +1 Query: 421 LAVVLQRRDWENPGVTQLNRLAAHPPFASCVIAKRPAPIALPNKLRSLNGE 573 LAVVLQRRDWENPGVTQLNRLAAHPPFAS ++ +LRSLNGE Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,311,867 Number of Sequences: 59808 Number of extensions: 544011 Number of successful extensions: 8566 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5750 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -