BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1011 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74033-5|CAF31473.1| 333|Caenorhabditis elegans Hypothetical pr... 28 5.0 U42833-2|AAA83576.1| 1276|Caenorhabditis elegans Hypothetical pr... 28 5.0 >Z74033-5|CAF31473.1| 333|Caenorhabditis elegans Hypothetical protein F38B7.7 protein. Length = 333 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -1 Query: 158 VI*IF-VLCSKHLMYSSVMFNYE*DKLDECDFNVIFDIPSLSNMYVCVPLYV 6 VI IF ++C+ ++Y + FN +K + FN+I SLSN+Y+ ++ Sbjct: 26 VIGIFGIVCNSSIVY--IFFN---EKSERTSFNLICVYRSLSNIYILATTFI 72 >U42833-2|AAA83576.1| 1276|Caenorhabditis elegans Hypothetical protein ZK430.5 protein. Length = 1276 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -2 Query: 553 CTVFEQNSIFISTKYFNSFLLLSDFTRTDAHHF 455 C ++ +S F +T+Y SF++ S+F++ HF Sbjct: 474 CVIYHSSSSF-ATEYMMSFMIYSNFSQLAIKHF 505 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,517,251 Number of Sequences: 27780 Number of extensions: 193013 Number of successful extensions: 367 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -