BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1004 (448 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.0 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.0 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.0 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 3.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 6.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.1 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 32 CPPLCPVDR*LAAICW 79 CP CP DR + I W Sbjct: 353 CPDCCPSDRMVYFITW 368 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 32 CPPLCPVDR*LAAICW 79 CP CP DR + I W Sbjct: 353 CPDCCPSDRMVYFITW 368 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 32 CPPLCPVDR*LAAICW 79 CP CP DR + I W Sbjct: 353 CPDCCPSDRMVYFITW 368 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 3.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 170 SSACISPLLDVGLSHSPPQCTILRLPHPISPSISPQVIG 54 S+A + + VGLS +P Q + L ++ S S V+G Sbjct: 160 STATVYVMSVVGLSKAPAQIPVDVLVLTVTLSASAMVLG 198 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 6.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 113 CTILRLPHPISPSISPQ 63 C +LPH P +SPQ Sbjct: 430 CLDGKLPHDDQPPLSPQ 446 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 8.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 105 PPPSASNLSQH 73 PPPSA N+ Q+ Sbjct: 766 PPPSAQNVPQN 776 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,000 Number of Sequences: 438 Number of extensions: 2674 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -