BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1003 (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 29 0.089 AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. 26 0.83 DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. 24 3.4 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 29.5 bits (63), Expect = 0.089 Identities = 9/39 (23%), Positives = 20/39 (51%) Frame = -1 Query: 525 GRSKQQGCVCGISCEWCSMRSISCNRCGSGVSRYRSDSF 409 G++ C+ +C WC+M + + RC + +Y + + Sbjct: 38 GKTTCSQCIQTTNCRWCTMPNFTHPRCHGQIEKYCPEEY 76 >AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. Length = 144 Score = 26.2 bits (55), Expect = 0.83 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 480 WCSMRSISCNRCGSGVSRYRSDSFGEERSTMRC 382 WC+ + N C S R D G++ MRC Sbjct: 79 WCAEGKVGANECKLQCSSLRDDDIGDD---MRC 108 >DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. Length = 144 Score = 24.2 bits (50), Expect = 3.4 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -1 Query: 480 WCSMRSISCNRCGSGVSRYRSDSFGEERSTMRC 382 WC+ + N C S R D+ ++ MRC Sbjct: 79 WCAEGKVGANECKLQCSSLRDDNIADD---MRC 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 416,562 Number of Sequences: 2352 Number of extensions: 4987 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -