Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1003
         (612 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    22   4.1  

>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
            receptor 1 protein.
          Length = 953

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 5/62 (8%)
 Frame = -3

Query: 592  LGLQGQRMSLVHQRIGM--GIGCVRAE*ATG---LRVRHKLRVVQHAQHKLQQVRQRRKS 428
            LGL+      +   +G+  GIG +  E A     +R + K+ + +HA  K +   ++RK+
Sbjct: 818  LGLKNMAGVFIVVGVGIIGGIGLIIIEVAYKKHQIRKQKKMELARHAADKWRGAIEKRKT 877

Query: 427  LQ 422
            L+
Sbjct: 878  LR 879


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,593
Number of Sequences: 438
Number of extensions: 1459
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18093444
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)