BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1002 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49079| Best HMM Match : DUF1393 (HMM E-Value=5.8) 29 4.0 SB_59204| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_30859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -3 Query: 493 LESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGYFE 365 +E LKT++ I + I ++ RR++ C+Q +GG+ E Sbjct: 115 IEKLKTAITAKINAIPKEECIKVIQNFARRVQVCLQRNGGHLE 157 >SB_49079| Best HMM Match : DUF1393 (HMM E-Value=5.8) Length = 299 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -1 Query: 579 PSSSPDLNPLDYKIWQHLEEKACSSLI 499 PSS+PD +D+ +W LEE+ + ++ Sbjct: 83 PSSNPDSPIVDFDLWSELEEEVLNYVV 109 >SB_59204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -3 Query: 505 PHPN-LESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGYFE*TLV 353 P P + SLK+ KA ++ + + P+RLK I+ GG+ TL+ Sbjct: 216 PQPRTMTSLKSRFKKAWRNVSLSTLSELSHSMPQRLKNVIKAKGGHANYTLI 267 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,036,122 Number of Sequences: 59808 Number of extensions: 327093 Number of successful extensions: 926 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -