BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1002 (618 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02850.1 68418.m00228 hydroxyproline-rich glycoprotein family... 27 10.0 At1g51480.1 68414.m05794 disease resistance protein (CC-NBS-LRR ... 27 10.0 >At5g02850.1 68418.m00228 hydroxyproline-rich glycoprotein family protein Length = 426 Score = 27.1 bits (57), Expect = 10.0 Identities = 12/45 (26%), Positives = 27/45 (60%) Frame = -3 Query: 520 KGMLKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQ 386 +G L P P E ++ S + AD+D+ L + +++ ++++A I+ Sbjct: 270 RGALPPAPQDEQMRASQLYTFADLDIGLPK-TVENMEKKVEALIE 313 >At1g51480.1 68414.m05794 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 941 Score = 27.1 bits (57), Expect = 10.0 Identities = 15/57 (26%), Positives = 31/57 (54%) Frame = +3 Query: 405 LRGQSSIAARTRSMSISAAALIKDVLSDSKLG*GLSMPFPPSVAISCNLTDSNLDWR 575 ++G +A+ R + ++ + + VLS + LG GL +SCN+++ +DW+ Sbjct: 761 IQGIDRLASSIRGLCLTNMSAPRVVLSTTALG-GLQQ----LAILSCNISEIKMDWK 812 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,566,812 Number of Sequences: 28952 Number of extensions: 229384 Number of successful extensions: 426 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -