BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1001 (628 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosa... 27 1.7 SPBP4H10.17c |||carboxyl methyl esterase|Schizosaccharomyces pom... 25 6.8 SPCC1672.09 |||triglyceride lipase-cholesterol esterase |Schizos... 25 9.0 >SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1029 Score = 27.5 bits (58), Expect = 1.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 148 LQTSKLRLHHEAPSQFSAYLRPFRSSRNRINTCNHC 41 LQ S+L H EA + F SR R+N N+C Sbjct: 603 LQESELASHAEAEINITYKFDNFSESRPRLNILNNC 638 >SPBP4H10.17c |||carboxyl methyl esterase|Schizosaccharomyces pombe|chr 2|||Manual Length = 341 Score = 25.4 bits (53), Expect = 6.8 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +3 Query: 348 ATSLPPITVEALGIIIPKVPQLIVDAVKLVVHGETDVEP 464 A S P+T E L KV L +D L HGET +EP Sbjct: 82 AMSFAPVTQELLSNSDNKVGFLALD---LRAHGETTLEP 117 >SPCC1672.09 |||triglyceride lipase-cholesterol esterase |Schizosaccharomyces pombe|chr 3|||Manual Length = 467 Score = 25.0 bits (52), Expect = 9.0 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -3 Query: 440 HNEFDGVNNQLWHFRYDDSKSFD 372 H FD + + W F DD +D Sbjct: 177 HLRFDSTDKEFWDFSIDDFAQYD 199 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,444,057 Number of Sequences: 5004 Number of extensions: 46927 Number of successful extensions: 152 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -