BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0998 (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.57 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 23 2.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.0 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 4.0 U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor prot... 22 4.0 AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin pr... 22 4.0 AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. 22 5.3 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 7.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.0 bits (52), Expect = 0.57 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +3 Query: 336 RQVAPHLSRLRSAGRGD-GHPLPRTLHHRRQAEPQADHHQRP 458 R++ RL + GD P + LHH + PQA +P Sbjct: 789 RRLMSEDKRLSKSVNGDQSQPPHQQLHHHQSTHPQAQAQAQP 830 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -3 Query: 394 GC-PSPRPALRSRERCGATCRLSEECSWDRVR 302 GC P P P+ R RC + ++S W R Sbjct: 42 GCVPKPIPSYACRGRCSSYLQVSGSKIWQMER 73 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +2 Query: 74 TAVVNGEFKDISLSDY 121 T +++ FKD+ LSD+ Sbjct: 1401 TPIMDAHFKDVKLSDF 1416 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.2 bits (45), Expect = 4.0 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +3 Query: 348 PHLSRLRSAGRGDGHPL----PRTLHHRRQAEPQAD 443 P L R A G+ P+ PR H R + EP+A+ Sbjct: 114 PRLRREPEAEPGNNRPVYIPQPRPPHPRLRREPEAE 149 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 393 PLPRTLHHRRQAEPQAD 443 P PR H R + EP+A+ Sbjct: 107 PQPRPPHPRLRREPEAE 123 >U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor protein. Length = 95 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 134 VVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCEVL 241 V + P++ F P E E+AD R++ C++L Sbjct: 15 VAIMAAPVEDEFE-PLEHFENEERADRHRRVTCDLL 49 >AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin precursor protein. Length = 95 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 134 VVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCEVL 241 V + P++ F P E E+AD R++ C++L Sbjct: 15 VAIMAAPVEDEFE-PLEHFENEERADRHRRVTCDLL 49 >AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. Length = 57 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 176 PTEIIAFSEKADEFRKIGCEVL 241 P E E+AD R++ C++L Sbjct: 3 PLEHFENEERADRHRRVTCDLL 24 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 78 AVALNWGAGLVICR 37 A+ ++W AG V+CR Sbjct: 99 AITVSWKAGDVMCR 112 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,241 Number of Sequences: 438 Number of extensions: 2811 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -