BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0996 (622 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 24 1.0 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 24 1.0 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 23 1.8 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 23 3.2 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 23 3.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.5 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 22 5.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.5 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 7.3 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.3 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 24.2 bits (50), Expect = 1.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 574 KYLLVIWWHYRSILH 618 K LL +WW Y+ I++ Sbjct: 65 KVLLSVWWDYKGIVY 79 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 24.2 bits (50), Expect = 1.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 574 KYLLVIWWHYRSILH 618 K LL +WW Y+ I++ Sbjct: 187 KVLLSVWWDYKGIVY 201 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 23.4 bits (48), Expect = 1.8 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = +1 Query: 574 KYLLVIWWHYRSILH 618 K LL++WW ++ I++ Sbjct: 66 KVLLLVWWDHKGIVY 80 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 281 MYALMLVLVTIVCCI 325 +Y L+ VLVTI C I Sbjct: 3 IYILLFVLVTITCVI 17 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 281 MYALMLVLVTIVCCI 325 +Y L+ VLVTI C I Sbjct: 3 IYILLFVLVTITCVI 17 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 91 QITSICILILLYALINIQIFY 29 QIT++C+ I L A + + Y Sbjct: 736 QITTLCVAISLSATVTLVCLY 756 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 63 NIKIQILVIWNVNCST*NKHHN 128 N+ ++IW ++CS K HN Sbjct: 14 NLNQNQMMIWALDCSIKPKDHN 35 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 91 QITSICILILLYALINIQIFY 29 QIT++C+ I L A + + Y Sbjct: 826 QITTLCVAISLSATVTLVCLY 846 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 146 LTLFVLIVMFVLCTTIYIPNN 84 + FVL M ++ + +PNN Sbjct: 7 IRFFVLTTMLMMAIAVELPNN 27 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 7.3 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 504 AISRKKRHVANVIL*TAKYPTASSQSTLKFPGN 406 A +RKK ++ A PT S T KFP N Sbjct: 338 AFARKKTDYSSFGKILATEPTLFSNVTPKFPRN 370 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,680 Number of Sequences: 438 Number of extensions: 3287 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -