BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0993 (601 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hor... 23 1.5 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 3.4 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 6.0 >EF222288-1|ABN79648.1| 73|Tribolium castaneum adipokinetic hormone 1 protein. Length = 73 Score = 23.4 bits (48), Expect = 1.5 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -2 Query: 129 NCREPL*ILMLIFK 88 NC+EP+ +MLI+K Sbjct: 41 NCKEPVETIMLIYK 54 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.2 bits (45), Expect = 3.4 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 352 LIIINTNGRLSPKQTRIFCLGHIQRNSQTIFNVR*ILQKKSFNSNYIGDLM 504 L I+ L P+ ++ LG RN++ I + L S + N GDL+ Sbjct: 104 LAILKQMRNLEPEFLKLDQLGATVRNNRQIRRMVVFLIGVSLSFNLFGDLL 154 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 188 PNNYINGSFFQTRFESNN 241 P NYIN F NN Sbjct: 39 PQNYINSYLFSLSLAQNN 56 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,457 Number of Sequences: 336 Number of extensions: 2526 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -