BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0993 (601 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0634 - 5085037-5085296,5085393-5085995,5087253-5087406,508... 27 8.7 >11_01_0634 - 5085037-5085296,5085393-5085995,5087253-5087406, 5087510-5087671,5087789-5088676 Length = 688 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 247 NVRIAYACHTKRKVMALD*WQESK*LQPS*LAERTLI 357 NV YA H K + + LD WQE + P + E+ ++ Sbjct: 109 NVWFRYAIHRKVRFLRLDVWQEEEFGNPVPIDEQPIV 145 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,020,796 Number of Sequences: 37544 Number of extensions: 230128 Number of successful extensions: 288 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 288 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -