BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0993 (601 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011139-1|AAR82807.1| 514|Drosophila melanogaster GM02553p pro... 29 6.4 AE013599-2468|AAF57863.2| 511|Drosophila melanogaster CG6530-PA... 28 8.4 >BT011139-1|AAR82807.1| 514|Drosophila melanogaster GM02553p protein. Length = 514 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 410 RQNMRVCLGESLPLVLIIISVRSAN*LGCNYFDSCHQSRAITF 282 + MR+ +G +L+++ +A GC++FD+ S+A F Sbjct: 1 QSEMRIVIGSFTAFLLLLLQNSNAEIPGCDFFDTVDISKAPRF 43 >AE013599-2468|AAF57863.2| 511|Drosophila melanogaster CG6530-PA protein. Length = 511 Score = 28.3 bits (60), Expect = 8.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 401 MRVCLGESLPLVLIIISVRSAN*LGCNYFDSCHQSRAITF 282 MR+ +G +L+++ +A GC++FD+ S+A F Sbjct: 1 MRIVIGSFTAFLLLLLQNSNAEIPGCDFFDTVDISKAPRF 40 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,094,665 Number of Sequences: 53049 Number of extensions: 430239 Number of successful extensions: 589 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2441585082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -