BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0987 (359 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 25 1.1 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 2.0 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 2.6 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 23 4.6 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 22 8.0 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 24.6 bits (51), Expect = 1.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 179 IHSRNNCS*VVRSPSEALGQLLANPTP 99 + S ++C+ ++ P E LGQ +AN P Sbjct: 34 LQSVHDCTEYLQIPKERLGQYMANEFP 60 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 41 GPKAFPVSPGQVGEQRLSQEGWDL 112 G K F PG++GE+ L E D+ Sbjct: 421 GEKGFKGEPGRIGERGLMGEKGDM 444 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 2.6 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 302 PKPAPSIRAECM 337 PKPAPS+ CM Sbjct: 51 PKPAPSLMTPCM 62 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 22.6 bits (46), Expect = 4.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +2 Query: 164 CFANESTTGSESRPAEKIRLETQRADAWVR 253 CF + + S+S +E + + +R+DA R Sbjct: 3 CFGSAGSKQSDSNSSEDTKSQKRRSDAITR 32 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 21.8 bits (44), Expect = 8.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 32 FTGGPKAFPV 61 FTG P AFPV Sbjct: 187 FTGAPAAFPV 196 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 308,969 Number of Sequences: 2352 Number of extensions: 5090 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26654730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -