BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0981 (597 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 25 0.48 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 7.9 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.9 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 25.0 bits (52), Expect = 0.48 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -1 Query: 552 SARASAGC----EAPRASPAAAHVRMCVQHGPHQRGAGARY 442 + RA+ C EA R PA H+R H H G G Y Sbjct: 286 TGRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVY 326 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 119 KNCLSLFFEIYCL 157 KNC+ + FE+Y L Sbjct: 256 KNCVIVIFELYYL 268 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 128 LSLFFEIYCLLITFAVH 178 L + YC+ ITF VH Sbjct: 53 LRRIYYFYCVSITFNVH 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,903 Number of Sequences: 336 Number of extensions: 1973 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -