BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0981 (597 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1223.11 |ptc2||protein phosphatase 2C Ptc2 |Schizosaccharomy... 26 3.6 SPAC869.11 ||SPAC922.08c|amino acid permease, unknown 6|Schizosa... 25 6.3 >SPCC1223.11 |ptc2||protein phosphatase 2C Ptc2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 370 Score = 26.2 bits (55), Expect = 3.6 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -1 Query: 576 RFLSESGPSARAS-AGCEAPRASPAAAHVRMCVQH-GPHQRGAGARYAADEDERQVA 412 R S GP A S A P A ++++ H H+ G+G Y +D D+ +A Sbjct: 307 RVNSGEGPCAPPSYAELRGPNTIADARNLQLEYDHIASHEYGSGDTYDSDSDDETIA 363 >SPAC869.11 ||SPAC922.08c|amino acid permease, unknown 6|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 25.4 bits (53), Expect = 6.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 122 NCLSLFFEIYCLLITFAVHTY 184 +C+ LFF I CL+ F V + Sbjct: 483 SCIGLFFNILCLMAQFYVSLF 503 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,855,763 Number of Sequences: 5004 Number of extensions: 30097 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -