BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0981 (597 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370038-1|ABD18599.1| 122|Anopheles gambiae putative TIL domai... 28 0.26 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 26 0.80 >DQ370038-1|ABD18599.1| 122|Anopheles gambiae putative TIL domain polypeptide protein. Length = 122 Score = 27.9 bits (59), Expect = 0.26 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 475 MLDAHPDVRCGRRRAW--CLASCR--CASTGPALRKKAC 579 M D PD +CG + W C +SC+ C L K C Sbjct: 18 MGDDDPDTKCGEKEVWDDCASSCQDICFEPPAELCDKKC 56 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 26.2 bits (55), Expect = 0.80 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 533 PADARALGPLSERKRAFSKQ 592 P+D +LGPLSERK + K+ Sbjct: 485 PSDESSLGPLSERKGSEKKR 504 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 478,272 Number of Sequences: 2352 Number of extensions: 7856 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -