BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0978 (638 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY874862-1|AAX59898.1| 424|Homo sapiens SH3-binding kinase prot... 31 4.6 AF272349-1|AAL36980.1| 193|Homo sapiens quaking protein 3 protein. 31 4.6 >AY874862-1|AAX59898.1| 424|Homo sapiens SH3-binding kinase protein. Length = 424 Score = 30.7 bits (66), Expect = 4.6 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -1 Query: 146 DTMRRCHRSKFSALPSLIGRRLRHYSLRPQRILL 45 DT++RC + AL + GR+L H ++P+ +LL Sbjct: 149 DTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLL 182 >AF272349-1|AAL36980.1| 193|Homo sapiens quaking protein 3 protein. Length = 193 Score = 30.7 bits (66), Expect = 4.6 Identities = 34/95 (35%), Positives = 39/95 (41%), Gaps = 6/95 (6%) Frame = +1 Query: 244 QPGPRAFTRRAQS------QGESSRPQTFGRSCRFLGELCHSDTSAEGCH*ICEAILGRR 405 QP PRA TR A++ + R + GR R LG SA G R Sbjct: 37 QPAPRARTRPAETRLPPARRPREGRAEPGGRERRRLGARRARAESACGGRASARCRPPRG 96 Query: 406 SR*EEEVEATPAHTGTPATEDPVPHPRLPRNHCLS 510 S E E E PA +GTP E P R PR LS Sbjct: 97 SAREPERE--PARSGTPGPERPAAGAR-PRPSLLS 128 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,315,366 Number of Sequences: 237096 Number of extensions: 1876786 Number of successful extensions: 9540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9540 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7028963750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -