BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0977 (459 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 24 0.78 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 2.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 4.2 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 4.2 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 4.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 4.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 4.2 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 21 5.5 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 21 5.5 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 21 5.5 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 21 5.5 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 5.5 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 21 5.5 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 21 5.5 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.3 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 7.3 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 7.3 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.8 bits (49), Expect = 0.78 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 288 IASCFSIQHPKVQQERSRLVLNANSENGQ 202 IA+C +Q PK+ E R + +SE + Sbjct: 47 IANCKLVQAPKLNAEVKRAITQQHSERDE 75 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 2.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 308 SDHWRGTRGSTSAASNDSARRQDGATC 388 SD + G+ T DSA Q+G TC Sbjct: 173 SDGYSGSYCQTEINECDSAPCQNGGTC 199 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +3 Query: 360 QHVVRMALHALDGLLYLHSQHVLHKDIA 443 +H++ +A G+ +L V+H+D+A Sbjct: 592 KHLLSIARQVALGMEHLAKTRVVHRDLA 619 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.4 bits (43), Expect = 4.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 199 HVRDGVRTTCSLLEEAAIPVLEMHVRRR 116 HV + V + S+++EAA V VR R Sbjct: 57 HVNEYVESLASIIDEAATKVHGTTVRVR 84 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 4.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 199 HVRDGVRTTCSLLEEAAIPVLEMHVRRR 116 HV + V + S+++EAA V VR R Sbjct: 371 HVNEYVESLASIIDEAATKVHGTTVRVR 398 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 199 HVRDGVRTTCSLLEEAAIPVLEMHVRRR 116 HV + V + S+++EAA V VR R Sbjct: 604 HVNEYVESLASIIDEAATKVHGTTVRVR 631 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 199 HVRDGVRTTCSLLEEAAIPVLEMHVRRR 116 HV + V + S+++EAA V VR R Sbjct: 604 HVNEYVESLASIIDEAATKVHGTTVRVR 631 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 21.0 bits (42), Expect = 5.5 Identities = 5/16 (31%), Positives = 11/16 (68%) Frame = +3 Query: 231 PNGSVLVVPWDAGWRN 278 P+G ++++ W + W N Sbjct: 77 PSGLIVIISWVSFWLN 92 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 21.0 bits (42), Expect = 5.5 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 321 LQWSLLCTPARIASCFSIQH 262 + W +CT I C S+ H Sbjct: 239 ISWQAVCTFYNILLCDSVAH 258 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 21.0 bits (42), Expect = 5.5 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 97 QEVLVKTVAEHASQVQVSLLLQEGCMLYGLHHERVL 204 Q VLV T + S + + C Y + H RVL Sbjct: 195 QNVLVPTASNSKSTKVLFKDVDRNCSAYIIAHYRVL 230 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 21.0 bits (42), Expect = 5.5 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 321 LQWSLLCTPARIASCFSIQH 262 + W +CT I C S+ H Sbjct: 239 ISWQAVCTFYNILLCDSVAH 258 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.0 bits (42), Expect = 5.5 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -1 Query: 321 LQWSLLCTPARIASCFSIQH 262 + W +CT I C S+ H Sbjct: 559 ISWQAVCTFYNILLCDSVAH 578 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 21.0 bits (42), Expect = 5.5 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 97 QEVLVKTVAEHASQVQVSLLLQEGCMLYGLHHERVL 204 Q VLV T + S + + C Y + H RVL Sbjct: 195 QNVLVPTASNSKSTKVLFKDVDRNCSAYIIAHYRVL 230 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 21.0 bits (42), Expect = 5.5 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 97 QEVLVKTVAEHASQVQVSLLLQEGCMLYGLHHERVL 204 Q VLV T + S + + C Y + H RVL Sbjct: 195 QNVLVPTASNSKSTKVLFKDVDRNCSAYIIAHYRVL 230 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.6 bits (41), Expect = 7.3 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +3 Query: 249 VVPWDAGWRNM 281 V W GW+NM Sbjct: 673 VTDWYTGWKNM 683 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 20.6 bits (41), Expect = 7.3 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 91 REQEVLVKTVAEHASQVQVSLLLQEGC 171 R+QE L + AS + L EGC Sbjct: 182 RQQEELCLVCGDRASGYHYNALTCEGC 208 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 20.6 bits (41), Expect = 7.3 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = +2 Query: 209 FSELALRTKRLRSCCTLGCWMEKHEAI 289 F L L RL S C G W+ + + Sbjct: 322 FISLGLLILRLVSVCFYGSWINEESKL 348 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,997 Number of Sequences: 336 Number of extensions: 2013 Number of successful extensions: 17 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -