BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0977 (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 38 2e-04 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 2.9 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 2.9 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 3.9 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 3.9 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 22 9.0 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 22 9.0 AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 22 9.0 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 37.5 bits (83), Expect = 2e-04 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +1 Query: 1 IQRCRVRLRSVAMEGTFGRVYRGTYADE-EAREQEVLVKTVAEHASQVQVSLLLQEGCML 177 I+ +R V G FGRV++G + E E+ + V +K + E + L+E ++ Sbjct: 829 IKEAEIRRGGVLGMGAFGRVFKGVWMPEGESVKIPVAIKVLMEMSGSESSKEFLEEAYIM 888 Query: 178 YGLHHERVLSVLGVSIEDQ 234 + H +L +L V + Q Sbjct: 889 ASVEHPNLLKLLAVCMTSQ 907 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 2.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 223 C*LRERTAHVRDGVRTTCSLLEEAA 149 C + E++ +GV+T+ L EEAA Sbjct: 653 CSIMEKSQKSGEGVKTSAKLAEEAA 677 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 2.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 223 C*LRERTAHVRDGVRTTCSLLEEAA 149 C + E++ +GV+T+ L EEAA Sbjct: 653 CSIMEKSQKSGEGVKTSAKLAEEAA 677 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.4 bits (48), Expect = 3.9 Identities = 6/26 (23%), Positives = 16/26 (61%) Frame = -1 Query: 99 LLSCFLISISPAVDSAERPLHRYGTQ 22 ++ +++ ++P+V+ P H +G Q Sbjct: 523 IVELYILDLTPSVNDLNHPFHLHGYQ 548 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 3.9 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = +3 Query: 258 WDAGWRNMKLFLLACRGVTIXXXXXXXXXXXLTTQHVVRMALHALDGLLYLHS 416 WD G+ L LL CR TI L ++ VR+ L DGL + S Sbjct: 37 WD-GYTEDDLTLL-CRLRTINSELENTNFSVLHPENTVRLRLQCNDGLFFQSS 87 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 22.2 bits (45), Expect = 9.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 312 SLLCTPARIASC 277 S+ C PAR ASC Sbjct: 75 SMRCAPARTASC 86 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 22.2 bits (45), Expect = 9.0 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +3 Query: 390 LDGLLYLHSQHVLHKDI 440 L+ L Y H ++H+D+ Sbjct: 105 LEALRYCHENDIIHRDV 121 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 22.2 bits (45), Expect = 9.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 13 RVRLRSVAMEGTFGRVYRGTYADE 84 +++L V +G FG V+RG + E Sbjct: 58 QIQLVDVIGKGRFGEVWRGRWRGE 81 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 481,497 Number of Sequences: 2352 Number of extensions: 9269 Number of successful extensions: 21 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -