BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0972 (624 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 24 1.2 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 23 2.7 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 23 2.7 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 23 2.7 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 8.4 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 519 GREGLVPHKLRISVVITDQIRVL*YI*NLFSVRLRALL 406 GRE + + ++V ITD+I ++ F+V LR +L Sbjct: 46 GRENFIYGSMNMTVAITDKIAN--FMLTFFNVSLRIIL 81 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 22.6 bits (46), Expect = 2.7 Identities = 13/47 (27%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 271 VFFA*YHLKIKTV--HHF*LV*IRVMLQCLEMCEFERCEVSDAISIW 405 + A Y+L+ + H F I ML CL F C +++W Sbjct: 192 IMLAQYYLQADMLLWHTFGYYHILAMLNCLCSLWFINCTAKGRVAVW 238 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 22.6 bits (46), Expect = 2.7 Identities = 13/47 (27%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 271 VFFA*YHLKIKTV--HHF*LV*IRVMLQCLEMCEFERCEVSDAISIW 405 + A Y+L+ + H F I ML CL F C +++W Sbjct: 192 IMLAQYYLQADMLLWHTFGYYHILAMLNCLCSLWFINCTAKGRVAVW 238 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 272 FFLHNII*KSKPCIIFNLY 328 FF N+I S+ C++ N+Y Sbjct: 43 FFKKNLIVGSENCLVLNVY 61 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/30 (23%), Positives = 17/30 (56%) Frame = +2 Query: 41 VRHLLSYFASLNLTFFVVLTEYTYSFIYNL 130 +RH + + S +++L + +S +Y+L Sbjct: 126 IRHPMKFSGSWKRARYLILAAWFFSALYSL 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,159 Number of Sequences: 336 Number of extensions: 2025 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -