BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0972 (624 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 27 1.7 SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pomb... 27 2.2 SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 25 8.9 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 27.5 bits (58), Expect = 1.7 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 352 LEMCEFERCEVSDAISIWQQRAESD*KQVLNVLKNSDLIRDHY 480 L C+FE + + ISI+ D +V VL + DHY Sbjct: 1100 LSSCKFEGYDPQNLISIYPPARFGDVTEVTKVLNRESVKLDHY 1142 >SPAC3H1.10 |||phytochelatin synthetase |Schizosaccharomyces pombe|chr 1|||Manual Length = 414 Score = 27.1 bits (57), Expect = 2.2 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 402 LATARGV*LKTSFKCIKELGFDP*SLH*FSAYEVLG-LRARSSSRRVVEQRGDRH 563 LA G L+T KC+K++ FD S + + A S R+V+ Q GD H Sbjct: 145 LANCNG--LRTITKCVKDVSFDEFRKDVISCSTIENKIMAISFCRKVLGQTGDGH 197 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 25.0 bits (52), Expect = 8.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 451 LIHLKLVFSQTPRAVARLI 395 LIH+ L F Q PR +A +I Sbjct: 46 LIHIPLSFLQQPRVIAEII 64 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,017,915 Number of Sequences: 5004 Number of extensions: 34624 Number of successful extensions: 72 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -