BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0972 (624 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38453| Best HMM Match : Sulfatase (HMM E-Value=3.1e-06) 35 0.047 SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) 29 2.3 >SB_38453| Best HMM Match : Sulfatase (HMM E-Value=3.1e-06) Length = 473 Score = 35.1 bits (77), Expect = 0.047 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 5 ASQQPVYLVRSYVRHLLSYFASLNLTFFVVLTEYTYSFIYNLIKHH 142 + + P++ V S +R L YF LNLTFF+ + + I L+ H Sbjct: 78 SGRYPIHTVFSVLRALADYFPQLNLTFFIQILDADPMAITELVSKH 123 >SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) Length = 1072 Score = 29.5 bits (63), Expect = 2.3 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = -3 Query: 565 PCRSPLCSTTRRLEDRARRPSTS*AEN*CSDHGSNPSSLIHLKLVFSQ-TPRAVARLILR 389 P SP STT R RR +S ++ S S S + L LV + T ++ L+ Sbjct: 629 PSASPQPSTTTEPGARKRRWGSSSSKKKTSVPISTESLKVSLTLVSKKKTSVPISTESLK 688 Query: 388 QKLRNVQIHTFQGTEALLVF 329 + + +VQ+H+ EAL+ F Sbjct: 689 ELIPDVQVHSTPAFEALMDF 708 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,738,268 Number of Sequences: 59808 Number of extensions: 245174 Number of successful extensions: 444 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -