BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0964 (636 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 53 7e-06 UniRef50_Q21413 Cluster: Putative uncharacterized protein; n=2; ... 33 4.4 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 52.8 bits (121), Expect = 7e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 117 FLLLRWVDELTAHLVLSGYWSP 52 FLLLRWVDELTAHLVLSGYWSP Sbjct: 154 FLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_Q21413 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 425 Score = 33.5 bits (73), Expect = 4.4 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 287 SSHVPPYNDITVNAVYYFRPKTKLGLNEDIHNTRLISASNVL 412 +SH P Y D++V + +F P ++GL ++ T L+S L Sbjct: 85 NSHNPEYIDLSVQLIVWFYPLAQIGLTMSVYVTILVSVHRYL 126 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 607,526,966 Number of Sequences: 1657284 Number of extensions: 11031647 Number of successful extensions: 22136 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22134 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47296372782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -