BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0964 (636 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74474-2|CAA98955.1| 425|Caenorhabditis elegans Hypothetical pr... 33 0.13 AC024843-5|AAK70666.3| 740|Caenorhabditis elegans Hypothetical ... 27 8.5 >Z74474-2|CAA98955.1| 425|Caenorhabditis elegans Hypothetical protein K10C8.2 protein. Length = 425 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 287 SSHVPPYNDITVNAVYYFRPKTKLGLNEDIHNTRLISASNVL 412 +SH P Y D++V + +F P ++GL ++ T L+S L Sbjct: 85 NSHNPEYIDLSVQLIVWFYPLAQIGLTMSVYVTILVSVHRYL 126 >AC024843-5|AAK70666.3| 740|Caenorhabditis elegans Hypothetical protein Y61A9LA.8 protein. Length = 740 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 31 HLRCRCPWAPVTT*HQVGCELVHPSKQ*KNFNNVALGI 144 H++ RC + P T C +HP+ KNF N GI Sbjct: 499 HVKERCIFWPKCTKGDT-CAFMHPTTNCKNFPNCTFGI 535 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,335,679 Number of Sequences: 27780 Number of extensions: 279608 Number of successful extensions: 492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -