BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0909 (354 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 1.4 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 22 2.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 4.3 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 5.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 5.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 20 7.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 20 7.5 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 20 7.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 20 9.9 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 20 9.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 20 9.9 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 1.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 339 GEVDSDTDDTGNE 301 GEVD D DD G++ Sbjct: 387 GEVDEDDDDDGDD 399 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 21.8 bits (44), Expect = 2.5 Identities = 14/54 (25%), Positives = 19/54 (35%) Frame = -3 Query: 259 ETRYDDILSIRSGRSNRSRASTATVGSKYKTGGKGIHRNLDSAASVASTLGGDY 98 E R D + SG + RA G + K GI+ + S G Y Sbjct: 236 EKRSTDFQDVESGSESFKRARMGFHGMRGKRDAAGIYGSNSSTVGTIFGYQGTY 289 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 4.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 332 LIRTPMTQATKPKAASLRSF*SPERN 255 L + P+TQ+ K A +L + P RN Sbjct: 331 LKKEPITQSNKRTAGNLATREHPSRN 356 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 20.6 bits (41), Expect = 5.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 211 RSRASTATVGSKYKTGG 161 RSR TATV + +GG Sbjct: 250 RSRMLTATVNRNHLSGG 266 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 20.6 bits (41), Expect = 5.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 37 VGSKDRACPSS*YRPWLSS 93 VGS+D P Y W SS Sbjct: 798 VGSEDSVIPRILYLTWYSS 816 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 20.2 bits (40), Expect = 7.5 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 303 RCLCHRCPNQLRR 341 R LC CP ++RR Sbjct: 403 RILCACCPGRVRR 415 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 20.2 bits (40), Expect = 7.5 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 342 SGEVDSDTDDTGNETQGGKPSKLLK 268 S +V S +D+GN KPS++++ Sbjct: 358 SAKVRSMFNDSGNPILKAKPSEVVQ 382 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 20.2 bits (40), Expect = 7.5 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +3 Query: 288 CRLGFRCLCHRC 323 C G +C C++C Sbjct: 79 CAEGMQCSCNKC 90 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 19.8 bits (39), Expect = 9.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 120 ATDAAESKFLCIPFPPVLYLEPT 188 A A+ S L + PP LEPT Sbjct: 664 AGTASHSTTLTVNVPPRWILEPT 686 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 19.8 bits (39), Expect = 9.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 303 RCLCHRCPNQLRR 341 +C C R N LRR Sbjct: 79 KCFCKRRTNTLRR 91 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 19.8 bits (39), Expect = 9.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 303 RCLCHRCPNQLRR 341 +C C R N LRR Sbjct: 527 KCFCKRRTNTLRR 539 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,094 Number of Sequences: 438 Number of extensions: 1082 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8184330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -