BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0906 (348 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0602 - 20912739-20913206 29 0.76 04_04_0674 + 27173948-27174188,27174704-27175260,27175310-271753... 27 4.0 >12_02_0602 - 20912739-20913206 Length = 155 Score = 29.5 bits (63), Expect = 0.76 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 31 LNCFHPKRRN--TSYYA*LEHVLLFNLVNKVIGNYYKNRIRLIF 156 LNC +PK N Y + H +L NLV +++G YY N F Sbjct: 110 LNCNYPKSINFERKYESFFTHWILTNLVKRIVG-YYINSTTCTF 152 >04_04_0674 + 27173948-27174188,27174704-27175260,27175310-27175399, 27175475-27175714,27175801-27176022,27176124-27176433, 27176528-27176847,27176906-27177021,27177133-27177227, 27177331-27177407,27177520-27177615 Length = 787 Score = 27.1 bits (57), Expect = 4.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 178 QREFGRRPVIPPTRNRRRF 234 +RE+GRR +PP R+R F Sbjct: 563 RREYGRRDELPPPRSRATF 581 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,401,894 Number of Sequences: 37544 Number of extensions: 107409 Number of successful extensions: 176 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 506210712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -