BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0906 (348 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 28 2.4 SB_27901| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.3 SB_4799| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.3 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 27.9 bits (59), Expect = 2.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 325 CLSYQKARYSTFYTRGRAR 269 C SY K RY T+ +G AR Sbjct: 816 CTSYDKRRYETYLNKGEAR 834 >SB_27901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 26.2 bits (55), Expect = 7.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 190 GRRPVIPPTRNRRRFLRLQSSFVVIRAVRG 279 GR+ +PPT + RF +QS++V RG Sbjct: 39 GRQERLPPTSDAFRFHAMQSNYVAKPIFRG 68 >SB_4799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1098 Score = 26.2 bits (55), Expect = 7.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 190 GRRPVIPPTRNRRRFLRLQSSFVVIRAVRG 279 GR+ +PPT + RF +QS++V RG Sbjct: 256 GRQERLPPTSDAFRFHAMQSNYVAKPIFRG 285 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,023,950 Number of Sequences: 59808 Number of extensions: 137200 Number of successful extensions: 349 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 523129866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -